PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_012644-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family CO-like
Protein Properties Length: 439aa    MW: 48528.3 Da    PI: 4.9848
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_012644-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.31.5e-081658339
       zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                   +r C+ + +k+++++C  ++ +lC+ C  + H+       H +
  NNU_012644-RA 16 ARACDSCLRKRARWYCAADDAFLCQGCDASVHSAnplarrHGR 58
                   578*****************************65666666765 PP

2CCT682.6e-23386429144
            CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                    Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  NNU_012644-RA 386 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 429
                    9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.4951461IPR000315B-box-type zinc finger
SMARTSM003367.1E-111461IPR000315B-box-type zinc finger
PfamPF006435.4E-71659IPR000315B-box-type zinc finger
CDDcd000215.39E-81761No hitNo description
PfamPF062037.4E-18386428IPR010402CCT domain
PROSITE profilePS5101716.083386428IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MSSDKKVANA VGGKTARACD SCLRKRARWY CAADDAFLCQ GCDASVHSAN PLARRHGRVR  60
LKTASFKPND DSLVENYVPA WHQGFTRKAR TPRHGKPTAL QQSKSTDHEE PIPNPLPLVP  120
EMGSEEASPD ENEEQLLYRV PIFDPFVAEL CTPATSNEAS MTANDSSTAA VGTETKAFLH  180
EGHDVTGDMD NLPGFLPSDM DLVEFAADVE TLLGKGLDED SFGMEGLGLL DCKDEEKTDC  240
CFGSGRVKVE EEEVEAAVEC HVEVELEHDM ARETLDLNFD YDSPTTAEDE VEEKMVTGAT  300
MMVTNGGCKA EETTRKTSLK LDYEAIISAW ANKGLPWTTG DRPLFNPDDC WPDCMGTCPM  360
TEVHHYHPYG EMGGVGGHVT AGDGGREARV SRYREKRRTR LFSKKIRYEV RKLNAEKRPR  420
MKGRFVKRAS CTGPAAFPF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1396412RRTRLFSKKIRYEVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265147.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
TrEMBLD7T9490.0D7T949_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03520.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.13e-94B-box type zinc finger protein with CCT domain